PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000127521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 335aa    MW: 37796.5 Da    PI: 6.5073
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000127521genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.7e-151563148
                     TSSS-HHHHHHHHHHHHH.TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkq.lGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEdell++++ + +G g+W++ ++  g+ R++k+c++rw +yl
    MDP0000127521 15 KGPWSPEEDELLLNYISKnHGHGSWRSLPKLAGLQRCGKSCRLRWINYL 63
                     79**************7637777************************97 PP

2Myb_DNA-binding44.63.3e-1469115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ ++E++l+++++ +lG++ W+tIa+ ++ gRt++++k+ w+++l
    MDP0000127521  69 RGPFNKDEEQLIIQLHGMLGNRWWATIASQLP-GRTDNEIKNLWNTHL 115
                      89******************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-22766IPR009057Homeodomain-like
PROSITE profilePS5129423.2221067IPR017930Myb domain
SuperFamilySSF466896.36E-2712111IPR009057Homeodomain-like
SMARTSM007175.5E-101465IPR001005SANT/Myb domain
PfamPF002499.3E-141563IPR001005SANT/Myb domain
CDDcd001671.42E-91763No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2267120IPR009057Homeodomain-like
PROSITE profilePS5129418.17968119IPR017930Myb domain
SMARTSM007177.1E-1168117IPR001005SANT/Myb domain
PfamPF002499.3E-1369115IPR001005SANT/Myb domain
CDDcd001675.08E-971115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRTPCCDNK KDLKKGPWSP EEDELLLNYI SKNHGHGSWR SLPKLAGLQR CGKSCRLRWI  60
NYLRPXIKRG PFNKDEEQLI IQLHGMLGNR WWATIASQLP GRTDNEIKNL WNTHLRKRLI  120
AMGIDPQTHE LLASNCLNHN ASASAATRHM AQWESARLEA EARLSRESSI FSHAPEKSES  180
DHFLRLWNSN VGKSFRKLTX DKFACQSPIS QASSSTKCGL LSAVTTEVGN NLTGSSTMAG  240
NQNEDLAYRP FLINTEDVEY KPFQFNTEEE GHKLFQSNTE AGEFKICQSN TEDRMXGSVS  300
SCSNDLENSS DTALQLLLDY PINDDMSFLE NNADD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-241211924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159950.0bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744650.0DQ074465.1 Malus x domestica MYB14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376023.10.0PREDICTED: myb-related protein Hv1
TrEMBLQ2LME70.0Q2LME7_MALDO; MYB14
STRINGPOPTR_0014s07700.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-113myb domain protein 17